Recombinant Human RBCK1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RBCK1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 36220 of Human C20orf18 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RBCK1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RBCK1 Protein

  • C20orf18
  • EC 6.3.2.-
  • HBV associated factor 4
  • HBV-associated factor 4
  • Heme-oxidized IRP2 ubiquitin ligase 1
  • Hepatitis B virus X-associated protein 4
  • HOIL-1
  • RanBP-type and C3HC4-type zinc finger containing 1
  • ranBP-type and C3HC4-type zinc finger-containing protein 1
  • RBCC protein interacting with PKC1
  • RBCK2
  • RNF54RING finger protein 54
  • UBCE7IP3HOIL1
  • ubiquitin conjugating enzyme 7 interacting protein 3
  • Ubiquitin-conjugating enzyme 7-interacting protein 3
  • XAP3
  • XAP4chromosome 20 open reading frame 18
  • ZRANB4

Background

C20orf18 - chromosome 20 open reading frame 18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8039
Species: Hu
Applications: WB, IHC, ICC
AF8100
Species: Hu
Applications: WB, IHC
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58069
Species: Hu
Applications: ICC/IF
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RBCK1 Partial Recombinant Protein (H00010616-Q01) (0)

There are no publications for RBCK1 Partial Recombinant Protein (H00010616-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBCK1 Partial Recombinant Protein (H00010616-Q01) (0)

There are no reviews for RBCK1 Partial Recombinant Protein (H00010616-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBCK1 Partial Recombinant Protein (H00010616-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBCK1 Products

Bioinformatics Tool for RBCK1 Partial Recombinant Protein (H00010616-Q01)

Discover related pathways, diseases and genes to RBCK1 Partial Recombinant Protein (H00010616-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBCK1 Partial Recombinant Protein (H00010616-Q01)

Discover more about diseases related to RBCK1 Partial Recombinant Protein (H00010616-Q01).
 

Pathways for RBCK1 Partial Recombinant Protein (H00010616-Q01)

View related products by pathway.

PTMs for RBCK1 Partial Recombinant Protein (H00010616-Q01)

Learn more about PTMs related to RBCK1 Partial Recombinant Protein (H00010616-Q01).
 

Research Areas for RBCK1 Partial Recombinant Protein (H00010616-Q01)

Find related products by research area.

Blogs on RBCK1

There are no specific blogs for RBCK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RBCK1 Antibody
NBP1-88301

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RBCK1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RBCK1