Recombinant Human RB associated KRAB repressor Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RB associated KRAB repressor Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 51-150 of Human RBAK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TTKPNVIIKLEQGEEPWIMGGEFPCQHSPEAWRVDDLIERIQENEDKHSRQAACINSKTLTEEKENTFSQIYMETSLVPSSIIAHNCVSCGKNLESISQL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RBAK

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RB associated KRAB repressor Protein

  • hRBaK
  • RB-associated KRAB repressor
  • RB-associated KRAB zinc finger protein
  • RB-associated KRAB zinc finger
  • ZNF769Zinc finger protein 769

Background

RBAK - RB-associated KRAB repressor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6947
Species: Hu
Applications: WB
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB100-230
Species: Hu
Applications: WB, IP, PLA
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00084289-T01
Species: Hu
AF4779
Species: Hu
Applications: WB, IHC
NBP1-56518
Species: Hu
Applications: WB
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NBP1-76592
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu

Publications for RB associated KRAB repressor Partial Recombinant Protein (H00057786-Q01) (0)

There are no publications for RB associated KRAB repressor Partial Recombinant Protein (H00057786-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RB associated KRAB repressor Partial Recombinant Protein (H00057786-Q01) (0)

There are no reviews for RB associated KRAB repressor Partial Recombinant Protein (H00057786-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RB associated KRAB repressor Partial Recombinant Protein (H00057786-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RB associated KRAB repressor Products

Bioinformatics Tool for RB associated KRAB repressor Partial Recombinant Protein (H00057786-Q01)

Discover related pathways, diseases and genes to RB associated KRAB repressor Partial Recombinant Protein (H00057786-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RB associated KRAB repressor Partial Recombinant Protein (H00057786-Q01)

Discover more about diseases related to RB associated KRAB repressor Partial Recombinant Protein (H00057786-Q01).
 

Pathways for RB associated KRAB repressor Partial Recombinant Protein (H00057786-Q01)

View related products by pathway.

Blogs on RB associated KRAB repressor

There are no specific blogs for RB associated KRAB repressor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RB associated KRAB repressor Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RBAK