RAX Antibody


Western Blot: RAX Antibody [NBP2-86766] - Host: Rabbit. Target Name: RAX. Sample Tissue: Mouse Brain lysates. Antibody Dilution: 1ug/ml

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

RAX Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of mouse RAX. Peptide sequence: ATRPCYPKEQGEARPSPGLSVGPAAGDSKLSEEEPPKKKHRRNRTTFTTY The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for RAX Antibody

  • MCOP3
  • retina and anterior neural fold homeobox
  • retinal homeobox protein Rx
  • RXRetina and anterior neural fold homeobox protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Bv, Fi
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB

Publications for RAX Antibody (NBP2-86766) (0)

There are no publications for RAX Antibody (NBP2-86766).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAX Antibody (NBP2-86766) (0)

There are no reviews for RAX Antibody (NBP2-86766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAX Antibody (NBP2-86766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RAX Products

Array NBP2-86766

Bioinformatics Tool for RAX Antibody (NBP2-86766)

Discover related pathways, diseases and genes to RAX Antibody (NBP2-86766). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAX Antibody (NBP2-86766)

Discover more about diseases related to RAX Antibody (NBP2-86766).

Pathways for RAX Antibody (NBP2-86766)

View related products by pathway.

PTMs for RAX Antibody (NBP2-86766)

Learn more about PTMs related to RAX Antibody (NBP2-86766).

Blogs on RAX

There are no specific blogs for RAX, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAX Antibody and receive a gift card or discount.


Gene Symbol RAX