Recombinant Human RASSF1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related RASSF1 Peptides and Proteins

Order Details


    • Catalog Number
      H00011186-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human RASSF1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 241-340 of Human RASSF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
RASSF1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RASSF1 Protein

  • 123F2
  • NORE2A
  • pancreas-specific ras association domain family 1 protein
  • Ras association (RalGDS/AF-6) domain family member 1
  • ras association domain-containing protein 1
  • RASSF1A
  • RDA32cardiac-specific ras association domain family 1 protein
  • REH3P21
  • tumor suppressor protein RDA32
  • WUGSC:H_LUCA12.5

Background

RASSF1 - Ras association (RalGDS/AF-6) domain family 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00011186-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RASSF1 Partial Recombinant Protein (H00011186-Q01) (0)

There are no publications for RASSF1 Partial Recombinant Protein (H00011186-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF1 Partial Recombinant Protein (H00011186-Q01) (0)

There are no reviews for RASSF1 Partial Recombinant Protein (H00011186-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RASSF1 Partial Recombinant Protein (H00011186-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RASSF1 Products

Bioinformatics Tool for RASSF1 Partial Recombinant Protein (H00011186-Q01)

Discover related pathways, diseases and genes to RASSF1 Partial Recombinant Protein (H00011186-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF1 Partial Recombinant Protein (H00011186-Q01)

Discover more about diseases related to RASSF1 Partial Recombinant Protein (H00011186-Q01).
 

Pathways for RASSF1 Partial Recombinant Protein (H00011186-Q01)

View related products by pathway.

PTMs for RASSF1 Partial Recombinant Protein (H00011186-Q01)

Learn more about PTMs related to RASSF1 Partial Recombinant Protein (H00011186-Q01).
 

Research Areas for RASSF1 Partial Recombinant Protein (H00011186-Q01)

Find related products by research area.

Blogs on RASSF1.

The role of DNMT3B in the co-incidence of methyltransferase and tumor suppressor expression in malignancies
Epigenetics is the process of heritable change in gene activity despite alteration of the hosts DNA sequence, essentially causing a change in a phenotype without a change in the genotype of a host. To change the gene sequence without interfering w...  Read full blog post.

Role of RASSF1A in Death Receptor-Dependent Apoptosis
Death-receptor apoptosis, or cell death, is essential for cellular growth regulation; its disruption is expressed in a variety of cancers. We at Novus Biologicals are one of the leading antibody suppliersfor apoptosis and cancer research groups, and t...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RASSF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RASSF1