![Western Blot: RASGEF1B Antibody [H00153020-B01P] - Analysis of RASGEF1B expression in transfected 293T cell line by RASGEF1B polyclonal antibody. Lane 1: RASGEF1B transfected lysate(23.1 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/RASGEF1B-Antibody-Western-Blot-H00153020-B01P-img0003.jpg "Western Blot: RASGEF1B Antibody [H00153020-B01P] - Analysis of RASGEF1B expression in transfected 293T cell line by RASGEF1B polyclonal antibody. Lane 1: RASGEF1B transfected lysate(23.1 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse RASGEF1B Antibody - Azide and BSA Free (H00153020-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | RASGEF1B (AAH36784.1, 1 a.a. - 210 a.a.) full-length human protein. MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDRTYIFTFLLSSRLFMHPYELMAKVCHLCVEHQRLSDPDSDKNQMRKIAPKILQLLTEWTETFPYDFRDERMMRNLKDLAHRIASGEEVGNLNLARLLEFPGRAWVGNGAELCILISTASSLFCLWASPPHHILVYLVCQVRMIIPSHFKGI |
| Specificity | Reacts with RasGEF domain family, member 1B. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | RASGEF1B |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
![Immunocytochemistry CCR7 Antibody (150503) [Unconjugated]](https://images.novusbio.com/images2/CCR7_MAB197_Immunocytochemistry_6580.jpg)
![Immunohistochemistry CCR7 Antibody (150503) [Unconjugated]](https://images.novusbio.com/images2/CCR7_MAB197_Immunohistochemistry_22800.jpg)
![Neutralization CCR7 Antibody (150503) [Unconjugated]](https://images.novusbio.com/images2/CCR7_MAB197_Block_Neutralize_9048.jpg)
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for RASGEF1B Antibody (H00153020-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RASGEF1B |
| Entrez |
|
| Uniprot |
|
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Immunohistochemistry EphA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA3_AF640_Immunohistochemistry_19184.jpg)
![Bioactivity TGF-beta 3 [Unconjugated]](https://images.novusbio.com/images/243-b3_recombinant-human-tgf-beta-3-protein-bioactivity-1342023172157.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")