RAS p21 Antibody

Images

 
Western Blot: RAS p21 Antibody [NBP1-74143] - Mouse Brain Lysate 1ug/ml Gel Concentration 6-18%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAS p21 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Rasa1. Immunizing peptide sequence SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Rasa1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAS p21 Antibody

  • CMAVM
  • DKFZp434N071
  • GAPp120GAPCM-AVM
  • GTPase-activating protein
  • p120RASGAP
  • PKWS
  • ras GTPase-activating protein 1
  • RAS p21 protein activator (GTPase activating protein) 1
  • Ras p21 protein activator
  • RASA
  • RASGAP
  • triphosphatase-activating protein

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-88154
Species: Hu, Mu
Applications: WB, IP, PLA
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00000420-B01P
Species: Hu
Applications: WB
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP1-74143
Species: Mu
Applications: WB

Publications for RAS p21 Antibody (NBP1-74143) (0)

There are no publications for RAS p21 Antibody (NBP1-74143).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAS p21 Antibody (NBP1-74143) (0)

There are no reviews for RAS p21 Antibody (NBP1-74143). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAS p21 Antibody (NBP1-74143) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAS p21 Products

Bioinformatics Tool for RAS p21 Antibody (NBP1-74143)

Discover related pathways, diseases and genes to RAS p21 Antibody (NBP1-74143). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAS p21 Antibody (NBP1-74143)

Discover more about diseases related to RAS p21 Antibody (NBP1-74143).
 

Pathways for RAS p21 Antibody (NBP1-74143)

View related products by pathway.

PTMs for RAS p21 Antibody (NBP1-74143)

Learn more about PTMs related to RAS p21 Antibody (NBP1-74143).

Blogs on RAS p21

There are no specific blogs for RAS p21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAS p21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASA1
Uniprot