Ras-GAP Antibody (6W10G6)

Western Blot: Ras-GAP Antibody (6W10G6) [NBP3-33535] - Western blot analysis of various lysates using at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Western Blot: Ras-GAP Antibody (6W10G6) [NBP3-33535] - Western blot analysis of lysates from mouse brain, using at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 6W10G6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Ras-GAP Antibody (6W10G6) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Ras-GAP (P20936).
  
  Sequence:
  KSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEIS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RASA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:100 - 1:500
• Theoretical MW: 116 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ras-GAP Antibody (6W10G6)

• CM-AVM
• CMAVM;CM-AVM;CMAVM1;GAP;p120;p120GAP;p120RASGAP;PKWS;Ras GTPase-activating protein 1;RASA;RASA1;RASGAP
• PKWS
• RASA1
• RasGAP
• Ras-GAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASA1