Recombinant Human RARRES3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related RARRES3 Peptides and Proteins

Order Details


    • Catalog Number
      H00005920-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human RARRES3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-164 of Human RARRES3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RARRES3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
43.78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RARRES3 Protein

  • HRASLS4
  • PLA1/2-3
  • RARRES3
  • RAR-responsive protein TIG3
  • retinoic acid receptor responder (tazarotene induced) 3
  • retinoic acid receptor responder protein 3
  • retinoic acid-inducible gene 1
  • Retinoid-inducible gene 1 protein
  • RIG1
  • Tazarotene-induced gene 3 protein
  • TIG3
  • TIG3MGC8906

Background

Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27419
Species: Hu, Pm
Applications: WB, IHC-P
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46429
Species: Hu
Applications: WB, IHC, IF
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3155
Species: Mu
Applications: WB, IHC
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-13732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
H00005920-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for RARRES3 Recombinant Protein (H00005920-P01) (0)

There are no publications for RARRES3 Recombinant Protein (H00005920-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RARRES3 Recombinant Protein (H00005920-P01) (0)

There are no reviews for RARRES3 Recombinant Protein (H00005920-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RARRES3 Recombinant Protein (H00005920-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RARRES3 Products

Bioinformatics Tool for RARRES3 Recombinant Protein (H00005920-P01)

Discover related pathways, diseases and genes to RARRES3 Recombinant Protein (H00005920-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RARRES3 Recombinant Protein (H00005920-P01)

Discover more about diseases related to RARRES3 Recombinant Protein (H00005920-P01).
 

Pathways for RARRES3 Recombinant Protein (H00005920-P01)

View related products by pathway.

PTMs for RARRES3 Recombinant Protein (H00005920-P01)

Learn more about PTMs related to RARRES3 Recombinant Protein (H00005920-P01).
 

Research Areas for RARRES3 Recombinant Protein (H00005920-P01)

Find related products by research area.

Blogs on RARRES3

There are no specific blogs for RARRES3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RARRES3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RARRES3
Entrez