RARRES3 Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related RARRES3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83214
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RARRES3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RARRES3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RARRES3 Antibody

  • HRASLS4
  • PLA1/2-3
  • RARRES3
  • RAR-responsive protein TIG3
  • retinoic acid receptor responder (tazarotene induced) 3
  • retinoic acid receptor responder protein 3
  • retinoic acid-inducible gene 1
  • Retinoid-inducible gene 1 protein
  • RIG1
  • Tazarotene-induced gene 3 protein
  • TIG3
  • TIG3MGC8906

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27419
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB110-1244
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-80859
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
NBP2-67741
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46429
Species: Hu
Applications: WB, IHC, IF
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, BA, Flow-IC
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3076
Species: Hu
Applications: WB, IHC
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NB200-322
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr

Publications for RARRES3 Antibody (NBP1-83214) (0)

There are no publications for RARRES3 Antibody (NBP1-83214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RARRES3 Antibody (NBP1-83214) (0)

There are no reviews for RARRES3 Antibody (NBP1-83214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RARRES3 Antibody (NBP1-83214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RARRES3 Products

Bioinformatics Tool for RARRES3 Antibody (NBP1-83214)

Discover related pathways, diseases and genes to RARRES3 Antibody (NBP1-83214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RARRES3 Antibody (NBP1-83214)

Discover more about diseases related to RARRES3 Antibody (NBP1-83214).
 

Pathways for RARRES3 Antibody (NBP1-83214)

View related products by pathway.

PTMs for RARRES3 Antibody (NBP1-83214)

Learn more about PTMs related to RARRES3 Antibody (NBP1-83214).
 

Research Areas for RARRES3 Antibody (NBP1-83214)

Find related products by research area.

Blogs on RARRES3

There are no specific blogs for RARRES3, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RARRES3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RARRES3