RAR alpha/NR1B1 Antibody (2C9-1F8) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related RAR alpha/NR1B1 Primary Antibodies

Order Details


    • Catalog Number
      H00005914-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RAR alpha/NR1B1 Antibody (2C9-1F8) [DyLight 488] Summary

Immunogen
RARA (AAH08727, 1 a.a. - 462 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Localization
Nuclear
Specificity
RARA - retinoic acid receptor, alpha
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RARA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAR alpha/NR1B1 Antibody (2C9-1F8) [DyLight 488]

  • alpha polypeptide
  • NR1B1
  • RAR alpha
  • RARA
  • RAR-alpha
  • retinoic acid receptor, alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-47314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF2944
Species: Hu
Applications: WB, Simple Western
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
H00005914-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for RAR alpha/NR1B1 Antibody (H00005914-M01G) (0)

There are no publications for RAR alpha/NR1B1 Antibody (H00005914-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAR alpha/NR1B1 Antibody (H00005914-M01G) (0)

There are no reviews for RAR alpha/NR1B1 Antibody (H00005914-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAR alpha/NR1B1 Antibody (H00005914-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAR alpha/NR1B1 Products

Bioinformatics Tool for RAR alpha/NR1B1 Antibody (H00005914-M01G)

Discover related pathways, diseases and genes to RAR alpha/NR1B1 Antibody (H00005914-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAR alpha/NR1B1 Antibody (H00005914-M01G)

Discover more about diseases related to RAR alpha/NR1B1 Antibody (H00005914-M01G).
 

Pathways for RAR alpha/NR1B1 Antibody (H00005914-M01G)

View related products by pathway.

PTMs for RAR alpha/NR1B1 Antibody (H00005914-M01G)

Learn more about PTMs related to RAR alpha/NR1B1 Antibody (H00005914-M01G).
 

Research Areas for RAR alpha/NR1B1 Antibody (H00005914-M01G)

Find related products by research area.

Blogs on RAR alpha/NR1B1

There are no specific blogs for RAR alpha/NR1B1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAR alpha/NR1B1 Antibody (2C9-1F8) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol RARA
Entrez