Recombinant Human RAPGEF5 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RAPGEF5 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 345-444 of Human RAPGEF5

Source: Wheat Germ

Amino Acid Sequence: AYRDAFKKMKPPKIPFVPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGDLSPKEHQELKSYVNHLYVIDSQQALFELSHRIEPRV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAPGEF5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAPGEF5 Protein

  • GFRREPAC
  • Guanine nucleotide exchange factor for Rap1
  • KIAA0277M-Ras-regulated GEF
  • M-Ras-regulated Rap GEF
  • MRGEF
  • MR-GEFrap guanine nucleotide exchange factor 5
  • Rap guanine nucleotide exchange factor (GEF) 5
  • Related to Epac
  • Repac

Background

RAPGEF5 - Rap guanine nucleotide exchange factor (GEF) 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-35212
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85467
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32244
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67605
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for RAPGEF5 Partial Recombinant Protein (H00009771-Q01) (0)

There are no publications for RAPGEF5 Partial Recombinant Protein (H00009771-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAPGEF5 Partial Recombinant Protein (H00009771-Q01) (0)

There are no reviews for RAPGEF5 Partial Recombinant Protein (H00009771-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAPGEF5 Partial Recombinant Protein (H00009771-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for RAPGEF5 Partial Recombinant Protein (H00009771-Q01)

Discover related pathways, diseases and genes to RAPGEF5 Partial Recombinant Protein (H00009771-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAPGEF5 Partial Recombinant Protein (H00009771-Q01)

Discover more about diseases related to RAPGEF5 Partial Recombinant Protein (H00009771-Q01).
 

Pathways for RAPGEF5 Partial Recombinant Protein (H00009771-Q01)

View related products by pathway.

Research Areas for RAPGEF5 Partial Recombinant Protein (H00009771-Q01)

Find related products by research area.

Blogs on RAPGEF5

There are no specific blogs for RAPGEF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532
RAPGEF5 Antibody
NBP2-57362

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAPGEF5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPGEF5