Recombinant Human RAPGEF3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RAPGEF3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 772-881 of Human RAPGEF3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FMPLLLKDMTFIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP

Protein/Peptide Type
Partial Recombinant Protein
Gene
RAPGEF3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAPGEF3 Protein

  • 9330170P05Rik
  • bcm910
  • cAMP-GEFI
  • cAMP-regulated guanine nucleotide exchange factor I
  • CGEF1
  • EPAC 1
  • EPAC1
  • EPACRAP guanine-nucleotide-exchange factor (GEF) 3
  • Exchange factor directly activated by cAMP 1
  • Exchange protein directly activated by cAMP 1
  • HSU79275
  • MGC21410
  • Rap guanine nucleotide exchange factor (GEF) 3
  • rap guanine nucleotide exchange factor 3
  • Rap1 guanine-nucleotide-exchange factor directly activated by cAMP

Background

RAPGEF3 - Rap guanine nucleotide exchange factor (GEF) 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-32009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24574
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RAPGEF3 Partial Recombinant Protein (H00010411-Q01) (0)

There are no publications for RAPGEF3 Partial Recombinant Protein (H00010411-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAPGEF3 Partial Recombinant Protein (H00010411-Q01) (0)

There are no reviews for RAPGEF3 Partial Recombinant Protein (H00010411-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAPGEF3 Partial Recombinant Protein (H00010411-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAPGEF3 Products

Bioinformatics Tool for RAPGEF3 Partial Recombinant Protein (H00010411-Q01)

Discover related pathways, diseases and genes to RAPGEF3 Partial Recombinant Protein (H00010411-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAPGEF3 Partial Recombinant Protein (H00010411-Q01)

Discover more about diseases related to RAPGEF3 Partial Recombinant Protein (H00010411-Q01).
 

Pathways for RAPGEF3 Partial Recombinant Protein (H00010411-Q01)

View related products by pathway.

PTMs for RAPGEF3 Partial Recombinant Protein (H00010411-Q01)

Learn more about PTMs related to RAPGEF3 Partial Recombinant Protein (H00010411-Q01).
 

Research Areas for RAPGEF3 Partial Recombinant Protein (H00010411-Q01)

Find related products by research area.

Blogs on RAPGEF3

There are no specific blogs for RAPGEF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RAPGEF3 Antibody
H00010411-D01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAPGEF3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPGEF3