Rap2B Antibody (4F12-3C6) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Rap2B Primary Antibodies

Order Details


    • Catalog Number
      H00005912-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Rap2B Antibody (4F12-3C6) [PE] Summary

Immunogen
RAP2B (AAH12362, 1 a.a. - 183 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
Localization
Cell membrane. Lipid-anchor; Cytoplasmic side.
Specificity
RAP2B - RAP2B, member of RAS oncogene family
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAP2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rap2B Antibody (4F12-3C6) [PE]

  • MGC20484
  • Rap2B
  • RAP2B, member of RAS oncogene family
  • Ras family small GTP binding protein RAP2B
  • ras-related protein Rap-2b
  • small GTP binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24574
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20072
Species: Hu
Applications: WB, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-52532
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF

Publications for Rap2B Antibody (H00005912-M01PE) (0)

There are no publications for Rap2B Antibody (H00005912-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rap2B Antibody (H00005912-M01PE) (0)

There are no reviews for Rap2B Antibody (H00005912-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rap2B Antibody (H00005912-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rap2B Products

Bioinformatics Tool for Rap2B Antibody (H00005912-M01PE)

Discover related pathways, diseases and genes to Rap2B Antibody (H00005912-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rap2B Antibody (H00005912-M01PE)

Discover more about diseases related to Rap2B Antibody (H00005912-M01PE).
 

Pathways for Rap2B Antibody (H00005912-M01PE)

View related products by pathway.

PTMs for Rap2B Antibody (H00005912-M01PE)

Learn more about PTMs related to Rap2B Antibody (H00005912-M01PE).
 

Research Areas for Rap2B Antibody (H00005912-M01PE)

Find related products by research area.

Blogs on Rap2B

There are no specific blogs for Rap2B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rap2B Antibody (4F12-3C6) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol RAP2B
Entrez