RANBP17 Antibody

Images

 
Immunohistochemistry-Paraffin: RANBP17 Antibody [NBP1-91028] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RANBP17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PVLMYVLTSISEGLTTLDTVVSSSCCTSLDYIVTYLFKHIAKEGKKPLRCREATQAGQRLLHFMQQNPDVLQQMMSVLMNTIVFEDCRNQWSVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RANBP17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RANBP17 Protein (NBP1-91028PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RANBP17 Antibody

  • FLJ32916
  • RAN binding protein 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

25280002
Species: Hu
Applications: ELISA, IHC, IHC-P
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NB100-2600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48800
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NBP1-87262
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-16392
Species: Hu
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP2-35010
Species: Hu
NB100-79814
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-13396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4697
Species: Hu
Applications: WB

Publications for RANBP17 Antibody (NBP1-91028) (0)

There are no publications for RANBP17 Antibody (NBP1-91028).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RANBP17 Antibody (NBP1-91028) (0)

There are no reviews for RANBP17 Antibody (NBP1-91028). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RANBP17 Antibody (NBP1-91028) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RANBP17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RANBP17