Recombinant Human RalB Protein

Images

 

Product Details

Summary
Product Discontinued
View other related RalB Peptides and Proteins

Order Details


    • Catalog Number
      H00005899-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human RalB Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-206 of Human RALB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
RALB

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RalB Protein

  • GTP binding protein
  • RalB
  • RAS-like protein B
  • ras-related protein Ral-B
  • v-ral simian leukemia viral oncogene homolog B (ras related; GTP bindingprotein)

Background

This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-83786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91444
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-97500
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha, Mk, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for RalB Recombinant Protein (H00005899-P01) (0)

There are no publications for RalB Recombinant Protein (H00005899-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RalB Recombinant Protein (H00005899-P01) (0)

There are no reviews for RalB Recombinant Protein (H00005899-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RalB Recombinant Protein (H00005899-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RalB Products

Bioinformatics Tool for RalB Recombinant Protein (H00005899-P01)

Discover related pathways, diseases and genes to RalB Recombinant Protein (H00005899-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RalB Recombinant Protein (H00005899-P01)

Discover more about diseases related to RalB Recombinant Protein (H00005899-P01).
 

Pathways for RalB Recombinant Protein (H00005899-P01)

View related products by pathway.

PTMs for RalB Recombinant Protein (H00005899-P01)

Learn more about PTMs related to RalB Recombinant Protein (H00005899-P01).
 

Research Areas for RalB Recombinant Protein (H00005899-P01)

Find related products by research area.

Blogs on RalB

There are no specific blogs for RalB, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RalB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RALB
Entrez