RAGEF2 Antibody (2C5) [Alexa Fluor® 488]

Images

 

Product Details

Summary
Product Discontinued
View other related RAGEF2 Primary Antibodies

Order Details


    • Catalog Number
      H00051735-M01AF488
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RAGEF2 Antibody (2C5) [Alexa Fluor® 488] Summary

Immunogen
RAPGEF6 (NP_057424, 1012 a.a. ~ 1111 a.a) partial recombinant protein with GST tag.LFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMISKEIRQVVRM TSANMDPAMMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSSL LNAKKLYEDAQMARK
Specificity
RAPGEF6 - Rap guanine nucleotide exchange factor (GEF) 6
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAPGEF6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
Alexa Fluor 488
Format
Alexa Fluor 488 (A=488, E=515-545)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Reactivity Notes

Human. Other species not tested.

Notes

Alexa Flour (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research.

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for RAGEF2 Antibody (2C5) [Alexa Fluor® 488]

  • DKFZp667N084
  • DKFZp686I15116
  • KIA001LB
  • PDZ domain-containing guanine nucleotide exchange factor 2
  • PDZ domain-containing guanine nucleotide exchange factor I
  • PDZ-GEF2RA-GEF-2PDZGEF2PDZ domain containing guanine nucleotide exchange factor (GEF) 2
  • RAGEF2
  • Rap guanine nucleotide exchange factor (GEF) 6
  • rap guanine nucleotide exchange factor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22527
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-06549
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24574
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB3429
Species: Hu
Applications: WB
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
AF1103
Species: Hu
Applications: WB, IHC, ICC
NBP1-81039
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20072
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48499
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2405
Species: Mu
Applications: WB, Flow, IHC

Publications for RAGEF2 Antibody (H00051735-M01AF488) (0)

There are no publications for RAGEF2 Antibody (H00051735-M01AF488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAGEF2 Antibody (H00051735-M01AF488) (0)

There are no reviews for RAGEF2 Antibody (H00051735-M01AF488). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAGEF2 Antibody (H00051735-M01AF488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAGEF2 Products

RAGEF2 H00051735-M01AF488

Related Products by Gene

Bioinformatics Tool for RAGEF2 Antibody (H00051735-M01AF488)

Discover related pathways, diseases and genes to RAGEF2 Antibody (H00051735-M01AF488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAGEF2 Antibody (H00051735-M01AF488)

Discover more about diseases related to RAGEF2 Antibody (H00051735-M01AF488).
 

Pathways for RAGEF2 Antibody (H00051735-M01AF488)

View related products by pathway.

Research Areas for RAGEF2 Antibody (H00051735-M01AF488)

Find related products by research area.

Blogs on RAGEF2

There are no specific blogs for RAGEF2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RAPGEF6

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00051735-M01AF488 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.