Recombinant Human RAG2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related RAG2 Peptides and Proteins

Order Details


    • Catalog Number
      H00005897-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human RAG2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 428-527 of Human RAG2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNEHVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAG2 Protein

  • RAG-2
  • recombination activating gene 2
  • V(D)J recombination-activating protein 2

Background

This gene encodes a protein that is involved in the initiation of V(D)J recombination during B and T cell development. This protein forms a complex with the product of the adjacent recombination activating gene 1, and this complex can form double-strand breaks by cleaving DNA at conserved recombination signal sequences. The recombination activating gene 1 component is thought to contain most of the catalytic activity, while the N-terminal of the recombination activating gene 2 component is thought to form a six-bladed propeller in the active core that serves as a binding scaffold for the tight association of the complex with DNA. A C-terminal plant homeodomain finger-like motif in this protein is necessary for interactions with chromatin components, specifically with histone H3 that is trimethylated at lysine 4. Mutations in this gene cause Omenn syndrome, a form of severe combined immunodeficiency associated with autoimmune-like symptoms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-74190
Species: Mu
Applications: WB, ChIP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF284
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NB100-88153
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-34098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005897-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for RAG2 Partial Recombinant Protein (H00005897-Q01) (0)

There are no publications for RAG2 Partial Recombinant Protein (H00005897-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAG2 Partial Recombinant Protein (H00005897-Q01) (0)

There are no reviews for RAG2 Partial Recombinant Protein (H00005897-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAG2 Partial Recombinant Protein (H00005897-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAG2 Products

Bioinformatics Tool for RAG2 Partial Recombinant Protein (H00005897-Q01)

Discover related pathways, diseases and genes to RAG2 Partial Recombinant Protein (H00005897-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAG2 Partial Recombinant Protein (H00005897-Q01)

Discover more about diseases related to RAG2 Partial Recombinant Protein (H00005897-Q01).
 

Pathways for RAG2 Partial Recombinant Protein (H00005897-Q01)

View related products by pathway.

PTMs for RAG2 Partial Recombinant Protein (H00005897-Q01)

Learn more about PTMs related to RAG2 Partial Recombinant Protein (H00005897-Q01).

Blogs on RAG2

There are no specific blogs for RAG2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAG2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAG2