RAD51AP1 Antibody


Western Blot: RAD51AP1 Antibody [NBP2-13197] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RAD51AP1 Antibody [NBP2-13197] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: RAD51AP1 Antibody [NBP2-13197] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Product Discontinued
View other related RAD51AP1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RAD51AP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSPHISNCSV ASDYLDLDKITVEDDVGGVQGKRKAASK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RAD51AP1 Antibody

  • PIR51RAD51-interacting protein
  • RAD51 associated protein 1
  • RAD51-associated protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Dr
Applications: ICC/IF (-), WB, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RAD51AP1 Antibody (NBP2-13197) (0)

There are no publications for RAD51AP1 Antibody (NBP2-13197).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAD51AP1 Antibody (NBP2-13197) (0)

There are no reviews for RAD51AP1 Antibody (NBP2-13197). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAD51AP1 Antibody (NBP2-13197) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RAD51AP1 Products

Bioinformatics Tool for RAD51AP1 Antibody (NBP2-13197)

Discover related pathways, diseases and genes to RAD51AP1 Antibody (NBP2-13197). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAD51AP1 Antibody (NBP2-13197)

Discover more about diseases related to RAD51AP1 Antibody (NBP2-13197).

Pathways for RAD51AP1 Antibody (NBP2-13197)

View related products by pathway.

PTMs for RAD51AP1 Antibody (NBP2-13197)

Learn more about PTMs related to RAD51AP1 Antibody (NBP2-13197).

Research Areas for RAD51AP1 Antibody (NBP2-13197)

Find related products by research area.

Blogs on RAD51AP1.

Determining DMC1's role in Homologus Recombination
The DMC1 gene encodes a 36.7 kDa nuclear protein involved in meiotic homologous recombination. This recombinase is functionally related to the yeast RAD51 and E. coli RecA genes. In contrast to RAD51, which functions in both mitotic and meiotic recomb...  Read full blog post.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAD51AP1 Antibody and receive a gift card or discount.


Gene Symbol RAD51AP1