Rabex5 Antibody


Western Blot: Rabex5 Antibody [NBP1-55342] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Rabex5 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Rabex5 Antibody Summary

Synthetic peptides corresponding to RABGEF1(RAB guanine nucleotide exchange factor (GEF) 1) The peptide sequence was selected from the N terminal of RABGEF1. Peptide sequence MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RABGEF1 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rabex5 Antibody

  • FLJ32302
  • RAB guanine nucleotide exchange factor (GEF) 1
  • rab5 GDP/GTP exchange factor
  • Rabaptin-5-associated exchange factor for Rab5
  • Rabex-5
  • RABEX5rabex-5
  • RAP1


RABGEF1 forms a complex with rabaptin-5 (RABPT5; MIM 603616) that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5 (RAB5A; MIM 179512) (Horiuchi et al., 1997 [PubMed 9323142]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu

Publications for Rabex5 Antibody (NBP1-55342) (0)

There are no publications for Rabex5 Antibody (NBP1-55342).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rabex5 Antibody (NBP1-55342) (0)

There are no reviews for Rabex5 Antibody (NBP1-55342). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rabex5 Antibody (NBP1-55342). (Showing 1 - 1 of 1 FAQ).

  1. Our customer would like to know if NBP1-55342 is suitable for detecting their sequence: MAERLKHKSKIHERLNNPELRCKTGCGFYGNPAWQGYCSVCFREVYLKQH Would you please help compare and suggest?
    • NBP1-55342 is a polyclonal antibody. The peptide sequence was selected from the N terminal of RABGEF1 Peptide sequence MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ. I did blast on the sequence you provided and that doesn't seem to be human RABGEF1, unfortunately I won't be able to assist your customer unless more information is provided. All I can say is that your customer could definitely use NBP1-55342 as longs as, the protein they are going to detect is human RABGEF1 and just in case they are using a truncated construct in transfected cells, the N-term should be intact. Please be advised that this antibody has only been validated in human.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Rabex5 Antibody (NBP1-55342)

Discover related pathways, diseases and genes to Rabex5 Antibody (NBP1-55342). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rabex5 Antibody (NBP1-55342)

Discover more about diseases related to Rabex5 Antibody (NBP1-55342).

Pathways for Rabex5 Antibody (NBP1-55342)

View related products by pathway.

PTMs for Rabex5 Antibody (NBP1-55342)

Learn more about PTMs related to Rabex5 Antibody (NBP1-55342).

Blogs on Rabex5

There are no specific blogs for Rabex5, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Rabex5 Antibody and receive a gift card or discount.


Gene Symbol RABGEF1