Novus Biologicals products are now on bio-techne.com

Rabenosyn 5 Antibody - Azide and BSA Free

Images

 
There are currently no images for Rabenosyn 5 Antibody (NBP3-03332).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Rabenosyn 5 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Rabenosyn 5 (NP_071735.2). MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKDRLLKREGDDRAESGTQGYESFSYGGVDPYMWEPQELGAVRSHLSDFKKHRAARIDHYVVEVNKLIIRLEKLTAFDRTNTESAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCRLCGSIMCKKCMELISLPLAN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBSN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for Rabenosyn 5 Antibody - Azide and BSA Free

  • 110 kDa protein
  • FLJ34993
  • FYVE finger-containing Rab5 effector protein rabenosyn-5
  • FYVE-finger-containing Rab5 effector protein rabenosyn-5
  • MGC126210
  • Rabenosyn-5
  • ZFYVE20
  • Zinc finger FYVE domain-containing protein 20
  • zinc finger, FYVE domain containing 20

Background

DNA binding protein involved in regulation of transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
2496-ZN
Species: Hu
Applications: EnzAct
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP2-37485
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB100-74648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-98931
Species: Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC-WhMt, IHC, WB
NB600-241
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IM, KD, Simple Western, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP3-22015
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
NB100-282
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-29906
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00004948-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for Rabenosyn 5 Antibody (NBP3-03332) (0)

There are no publications for Rabenosyn 5 Antibody (NBP3-03332).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rabenosyn 5 Antibody (NBP3-03332) (0)

There are no reviews for Rabenosyn 5 Antibody (NBP3-03332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rabenosyn 5 Antibody (NBP3-03332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rabenosyn 5 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RBSN