RAB9A Antibody (1E12) [Alexa Fluor 405]

Images

 

Product Details

Summary
Product Discontinued
View other related RAB9A Primary Antibodies

Order Details


    • Catalog Number
      H00009367-M01AF405
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RAB9A Antibody (1E12) [Alexa Fluor 405] Summary

Immunogen
RAB9A (NP_004242, 17 a.a. ~ 116 a.a) partial recombinant protein with GST tag.GVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTM QIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSN WKKEFIYYADVKEPE
Localization
Cell Membrane (lipid anchor; cytoplasmic side).
Marker
Endosome Marker
Specificity
RAB9A - RAB9A, member RAS oncogene family
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB9A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
Alexa Fluor 405
Format
Alexa Fluor 405 (A=405, E=421)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Notes

Alexa Flour (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research.

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for RAB9A Antibody (1E12) [Alexa Fluor 405]

  • RAB9A, member RAS oncogene family
  • RAB9RAB9, member RAS oncogene family
  • ras-related protein Rab-9A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB110-40764
Species: Hu, Mu, Po, Pm
Applications: WB, ICC/IF
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB120-13253
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB8978
Species: Hu, Mu, Rt
Applications: WB
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14041
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89788
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP

Publications for RAB9A Antibody (H00009367-M01AF405) (0)

There are no publications for RAB9A Antibody (H00009367-M01AF405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB9A Antibody (H00009367-M01AF405) (0)

There are no reviews for RAB9A Antibody (H00009367-M01AF405). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB9A Antibody (H00009367-M01AF405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB9A Antibody (1E12) [Alexa Fluor 405] Products

Related Products by Gene

Bioinformatics Tool for RAB9A Antibody (H00009367-M01AF405)

Discover related pathways, diseases and genes to RAB9A Antibody (H00009367-M01AF405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB9A Antibody (H00009367-M01AF405)

Discover more about diseases related to RAB9A Antibody (H00009367-M01AF405).
 

Pathways for RAB9A Antibody (H00009367-M01AF405)

View related products by pathway.

PTMs for RAB9A Antibody (H00009367-M01AF405)

Learn more about PTMs related to RAB9A Antibody (H00009367-M01AF405).
 

Research Areas for RAB9A Antibody (H00009367-M01AF405)

Find related products by research area.

Blogs on RAB9A

There are no specific blogs for RAB9A, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RAB9A

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00009367-M01AF405 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.