Recombinant Human RAB8B Protein

Images

 

Product Details

Summary
Product Discontinued
View other related RAB8B Peptides and Proteins

Order Details


    • Catalog Number
      H00051762-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human RAB8B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 101-207 of Human RAB8B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAB8B

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAB8B Protein

  • FLJ38125
  • RAB-8b protein
  • RAB8B, member RAS oncogene family
  • ras-related protein Rab-8B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-80991
Species: Hu
Applications: IHC, IHC-P
NBP1-92307
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-69184
Species: Mu, Rt
Applications: WB
NBP1-87185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051762-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RAB8B Partial Recombinant Protein (H00051762-Q01) (0)

There are no publications for RAB8B Partial Recombinant Protein (H00051762-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB8B Partial Recombinant Protein (H00051762-Q01) (0)

There are no reviews for RAB8B Partial Recombinant Protein (H00051762-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB8B Partial Recombinant Protein (H00051762-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB8B Products

Bioinformatics Tool for RAB8B Partial Recombinant Protein (H00051762-Q01)

Discover related pathways, diseases and genes to RAB8B Partial Recombinant Protein (H00051762-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB8B Partial Recombinant Protein (H00051762-Q01)

Discover more about diseases related to RAB8B Partial Recombinant Protein (H00051762-Q01).
 

Pathways for RAB8B Partial Recombinant Protein (H00051762-Q01)

View related products by pathway.

PTMs for RAB8B Partial Recombinant Protein (H00051762-Q01)

Learn more about PTMs related to RAB8B Partial Recombinant Protein (H00051762-Q01).
 

Research Areas for RAB8B Partial Recombinant Protein (H00051762-Q01)

Find related products by research area.

Blogs on RAB8B

There are no specific blogs for RAB8B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAB8B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB8B