Recombinant Human Rab27a Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Rab27a Peptides and Proteins

Order Details


    • Catalog Number
      H00005873-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Rab27a Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 122-221 of Human RAB27A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAB27A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Rab27a Protein

  • GS2
  • GS2rab-27
  • GTP-binding protein Ram
  • HsT18676
  • Rab-27
  • Rab27a
  • RAB27A, member RAS oncogene family
  • RAB27MGC117246
  • RAM
  • RAMras-related protein Rab-27A

Background

RAB27A - RAB27A, member RAS oncogene family

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00487
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
H00005874-B01P
Species: Hu, Rb
Applications: WB, ICC/IF
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-41385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1278
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
NBP1-80991
Species: Hu
Applications: IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Rab27a Partial Recombinant Protein (H00005873-Q01) (0)

There are no publications for Rab27a Partial Recombinant Protein (H00005873-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab27a Partial Recombinant Protein (H00005873-Q01) (0)

There are no reviews for Rab27a Partial Recombinant Protein (H00005873-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab27a Partial Recombinant Protein (H00005873-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rab27a Products

Bioinformatics Tool for Rab27a Partial Recombinant Protein (H00005873-Q01)

Discover related pathways, diseases and genes to Rab27a Partial Recombinant Protein (H00005873-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab27a Partial Recombinant Protein (H00005873-Q01)

Discover more about diseases related to Rab27a Partial Recombinant Protein (H00005873-Q01).
 

Pathways for Rab27a Partial Recombinant Protein (H00005873-Q01)

View related products by pathway.

PTMs for Rab27a Partial Recombinant Protein (H00005873-Q01)

Learn more about PTMs related to Rab27a Partial Recombinant Protein (H00005873-Q01).
 

Research Areas for Rab27a Partial Recombinant Protein (H00005873-Q01)

Find related products by research area.

Blogs on Rab27a

There are no specific blogs for Rab27a, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Rab27a Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB27A
Entrez