Rab24 Antibody


Western Blot: Rab24 Antibody [NBP2-84233] - Host: Rabbit. Target Name: RAB24. Sample Tissue: Human LN18 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Rab24 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle terminal region of human Rab24. Peptide sequence: VCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVD The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for Rab24 Antibody

  • RAB24, member RAS oncogene family
  • ras-related protein Rab-24


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Rab24 Antibody (NBP2-84233) (0)

There are no publications for Rab24 Antibody (NBP2-84233).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab24 Antibody (NBP2-84233) (0)

There are no reviews for Rab24 Antibody (NBP2-84233). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab24 Antibody (NBP2-84233) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Rab24 Products

Bioinformatics Tool for Rab24 Antibody (NBP2-84233)

Discover related pathways, diseases and genes to Rab24 Antibody (NBP2-84233). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab24 Antibody (NBP2-84233)

Discover more about diseases related to Rab24 Antibody (NBP2-84233).

Pathways for Rab24 Antibody (NBP2-84233)

View related products by pathway.

PTMs for Rab24 Antibody (NBP2-84233)

Learn more about PTMs related to Rab24 Antibody (NBP2-84233).

Research Areas for Rab24 Antibody (NBP2-84233)

Find related products by research area.

Blogs on Rab24

There are no specific blogs for Rab24, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Rab24 Antibody and receive a gift card or discount.


Gene Symbol RAB24