R-Spondin 4 Antibody

Images

 
Immunohistochemistry-Paraffin: R-Spondin 4 Antibody [NBP2-30540] - Staining of human small intestine shows strong luminal membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

R-Spondin 4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KCLHDCPPGYFGIRGQEVNRCKKCGATCESCFSQDFCIRCKRQFYLYKGKCLPTCPPGTLAHQNTRECQGECELGPWG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RSPO4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
R-Spondin 4 Protein (NBP2-30540PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for R-Spondin 4 Antibody

  • C20orf182
  • chromosome 20 open reading frame 182
  • Cristin 4
  • CRISTIN4
  • dJ824F16.3
  • FLJ16018
  • hRspo4
  • Roof plate-specific spondin-4
  • RSPO4
  • RSpondin 4
  • R-Spondin 4
  • R-spondin family, member 4
  • R-spondin-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3656
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB300-135
Species: Hu, Mu, Rt, Po, Bv, Fe
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00058524-R01
Species: Hu
NBP2-32507
Species: Hu
Applications: ICC/IF, IHC, IHC-P
24420002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37897
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45442
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF

Publications for R-Spondin 4 Antibody (NBP2-30540) (0)

There are no publications for R-Spondin 4 Antibody (NBP2-30540).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for R-Spondin 4 Antibody (NBP2-30540) (0)

There are no reviews for R-Spondin 4 Antibody (NBP2-30540). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for R-Spondin 4 Antibody (NBP2-30540) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional R-Spondin 4 Products

Bioinformatics Tool for R-Spondin 4 Antibody (NBP2-30540)

Discover related pathways, diseases and genes to R-Spondin 4 Antibody (NBP2-30540). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for R-Spondin 4 Antibody (NBP2-30540)

Discover more about diseases related to R-Spondin 4 Antibody (NBP2-30540).
 

Pathways for R-Spondin 4 Antibody (NBP2-30540)

View related products by pathway.

PTMs for R-Spondin 4 Antibody (NBP2-30540)

Learn more about PTMs related to R-Spondin 4 Antibody (NBP2-30540).

Blogs on R-Spondin 4

There are no specific blogs for R-Spondin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our R-Spondin 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RSPO4
Entrez
Uniprot