Pyruvate Dehydrogenase E1 beta subunit Antibody

Images

 
Western Blot: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP1-57601] - Human Heart lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP1-57601] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other ...read more

Order Details


    • Catalog Number
      NBP1-57601
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Pyruvate Dehydrogenase E1 beta subunit Antibody Summary

Immunogen
Synthetic peptides corresponding to PDHB(pyruvate dehydrogenase (lipoamide) beta) The peptide sequence was selected from the N terminal of PDHB. Peptide sequence GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID.
Clonality
Polyclonal
Host
Rabbit
Gene
PDHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against PDHB and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Pyruvate Dehydrogenase E1 beta subunit Antibody

  • DKFZp564K0164
  • mitochondrial
  • pyruvate dehydrogenase (lipoamide) beta
  • pyruvate dehydrogenase, E1 beta polypeptide

Background

The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-93479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP2-56992
Species: Hu
Applications: IHC-P
AF6014
Species: Hu, Mu, Rt
Applications: WB
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15131
Species: Hu
Applications: WB
NBP2-30684
Species: Hu
Applications: IHC, IHC-P
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-13408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59840
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-45844
Species: Hu
Applications: WB, IHC

Publications for Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601) (0)

There are no publications for Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601) (0)

There are no reviews for Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pyruvate Dehydrogenase E1 beta subunit Products

Bioinformatics Tool for Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601)

Discover related pathways, diseases and genes to Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601)

Discover more about diseases related to Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601).
 

Pathways for Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601)

View related products by pathway.

PTMs for Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601)

Learn more about PTMs related to Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP1-57601).

Blogs on Pyruvate Dehydrogenase E1 beta subunit

There are no specific blogs for Pyruvate Dehydrogenase E1 beta subunit, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pyruvate Dehydrogenase E1 beta subunit Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDHB
Uniprot