Pyruvate Carboxylase Antibody


Western Blot: Pyruvate Carboxylase Antibody [NBP1-69135] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: Pyruvate Carboxylase Antibody [NBP1-69135] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Western Blot: Pyruvate Carboxylase Antibody [NBP1-69135] - Lanes: 1 : 45ug human capan1 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene more

Product Details

Product Discontinued
View other related Pyruvate Carboxylase Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Pyruvate Carboxylase Antibody Summary

Synthetic peptides corresponding to PC (pyruvate carboxylase) The peptide sequence was selected from the C terminal of PC. Peptide sequence SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PC and was validated on Western blot.
Theoretical MW
127 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Pyruvate Carboxylase Antibody

  • EC 6.4.1
  • EC
  • PCBPyruvic carboxylase
  • pyruvate carboxylase
  • pyruvate carboxylase, mitochondrial


This gene encodes pyruvate carboxylase, which requires biotin and ATP to catalyse the carboxylation of pyruvate to oxaloacetate. The active enzyme is a homotetramer arranged in a tetrahedron which is located exclusively in the mitochondrial matrix. Pyruvate carboxylase is involved in gluconeogenesis, lipogenesis, insulin secretion and synthesis of the neurotransmitter glutamate. Mutations in this gene have been associated with pyruvate carboxylase deficiency. Alternatively spliced transcript variants with different 5' UTRs, but encoding the same protein, have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC

Publications for Pyruvate Carboxylase Antibody (NBP1-69135) (0)

There are no publications for Pyruvate Carboxylase Antibody (NBP1-69135).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pyruvate Carboxylase Antibody (NBP1-69135) (0)

There are no reviews for Pyruvate Carboxylase Antibody (NBP1-69135). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pyruvate Carboxylase Antibody (NBP1-69135) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Pyruvate Carboxylase Products

Bioinformatics Tool for Pyruvate Carboxylase Antibody (NBP1-69135)

Discover related pathways, diseases and genes to Pyruvate Carboxylase Antibody (NBP1-69135). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pyruvate Carboxylase Antibody (NBP1-69135)

Discover more about diseases related to Pyruvate Carboxylase Antibody (NBP1-69135).

Pathways for Pyruvate Carboxylase Antibody (NBP1-69135)

View related products by pathway.

PTMs for Pyruvate Carboxylase Antibody (NBP1-69135)

Learn more about PTMs related to Pyruvate Carboxylase Antibody (NBP1-69135).

Research Areas for Pyruvate Carboxylase Antibody (NBP1-69135)

Find related products by research area.

Blogs on Pyruvate Carboxylase

There are no specific blogs for Pyruvate Carboxylase, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Pyruvate Carboxylase Antibody and receive a gift card or discount.


Gene Symbol PC