PYROXD2 Antibody

Images

 
Western Blot: PYROXD2 Antibody [NBP1-70694] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related PYROXD2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-70694
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PYROXD2 Antibody Summary

Immunogen
Synthetic peptides corresponding to C10ORF33 The peptide sequence was selected from the N terminal of C10ORF33. Peptide sequence MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAA.
Clonality
Polyclonal
Host
Rabbit
Gene
PYROXD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C10orf33 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PYROXD2 Antibody

  • FLJ12197
  • MGC13047
  • pyridine nucleotide-disulphide oxidoreductase domain 2

Background

The exact function of C10orf33 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4840
Species: Hu
Applications: WB
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-02249
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32731
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-31848
Species: Hu
Applications: IHC, IHC-P
NBP1-76888
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
MAB7185
Species: Hu
Applications: WB, Simple Western
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-97823
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-14113
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00005095-B01P
Species: Hu
Applications: WB
NBP1-70694
Species: Hu
Applications: WB

Publications for PYROXD2 Antibody (NBP1-70694) (0)

There are no publications for PYROXD2 Antibody (NBP1-70694).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PYROXD2 Antibody (NBP1-70694) (0)

There are no reviews for PYROXD2 Antibody (NBP1-70694). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PYROXD2 Antibody (NBP1-70694) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PYROXD2 Products

Bioinformatics Tool for PYROXD2 Antibody (NBP1-70694)

Discover related pathways, diseases and genes to PYROXD2 Antibody (NBP1-70694). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PYROXD2 Antibody (NBP1-70694)

Discover more about diseases related to PYROXD2 Antibody (NBP1-70694).
 

Pathways for PYROXD2 Antibody (NBP1-70694)

View related products by pathway.

PTMs for PYROXD2 Antibody (NBP1-70694)

Learn more about PTMs related to PYROXD2 Antibody (NBP1-70694).

Blogs on PYROXD2

There are no specific blogs for PYROXD2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PYROXD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PYROXD2