PYK2/FAK2 Antibody

Images

 
Western Blot: PYK2 Antibody [NBP1-59189] - Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate.

Product Details

Summary
Product Discontinued
View other related PYK2/FAK2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59189
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PYK2/FAK2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PTK2B (PTK2B protein tyrosine kinase 2 beta) The peptide sequence was selected from the C terminal of PTK2B. Peptide sequence KSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMEL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTK2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PTK2B and was validated on Western blot.
Control
PYK2/FAK2 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PYK2/FAK2 Antibody

  • CADTK
  • CADTKCAK-beta
  • CAK beta
  • CAKB
  • Calcium-dependent tyrosine kinase
  • Cell adhesion kinase beta
  • EC 2.7.10
  • FADK2
  • FAK2
  • FAK2EC 2.7.10.2
  • Focal adhesion kinase 2
  • FRNK
  • PKB
  • Proline-rich tyrosine kinase 2
  • protein kinase B
  • protein tyrosine kinase 2 beta
  • protein-tyrosine kinase 2-beta
  • PTK
  • PTK2B protein tyrosine kinase 2 beta
  • PTK2B
  • PYK2
  • PYK2Related adhesion focal tyrosine kinase
  • RAFTK
  • RAFTKFADK 2

Background

PTK2B encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-46411
Species: Hu
Applications: WB, IHC
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55408
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-240
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-82001
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PYK2/FAK2 Antibody (NBP1-59189) (0)

There are no publications for PYK2/FAK2 Antibody (NBP1-59189).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PYK2/FAK2 Antibody (NBP1-59189) (0)

There are no reviews for PYK2/FAK2 Antibody (NBP1-59189). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PYK2/FAK2 Antibody (NBP1-59189) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PYK2/FAK2 Products

Bioinformatics Tool for PYK2/FAK2 Antibody (NBP1-59189)

Discover related pathways, diseases and genes to PYK2/FAK2 Antibody (NBP1-59189). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PYK2/FAK2 Antibody (NBP1-59189)

Discover more about diseases related to PYK2/FAK2 Antibody (NBP1-59189).
 

Pathways for PYK2/FAK2 Antibody (NBP1-59189)

View related products by pathway.

PTMs for PYK2/FAK2 Antibody (NBP1-59189)

Learn more about PTMs related to PYK2/FAK2 Antibody (NBP1-59189).
 

Research Areas for PYK2/FAK2 Antibody (NBP1-59189)

Find related products by research area.

Blogs on PYK2/FAK2

There are no specific blogs for PYK2/FAK2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PYK2/FAK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTK2B
Uniprot