PYDC2 Antibody

Images

 
Immunohistochemistry: PYDC2 Antibody [NBP2-31035] - Staining of human liver shows strong nuclear positivity in hepatocytes.

Product Details

Summary
Product Discontinued
View other related PYDC2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-31035
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PYDC2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QLVEIFTSHSCSYWAGMAAIQVFEKMNRTHLSGRADEHCVM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PYDC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PYDC2 Antibody

  • cPOP2
  • POP2
  • Pyrin Domain Containing 2
  • Pyrin Domain-Containing Protein 2
  • Pyrin-Only Protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15930
Species: Hu
Applications: WB, ICC/IF
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26606
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP, ICC
NB100-56076
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-P, IP
AF4986
Species: Hu
Applications: WB
NBP2-46323
Species: Hu
Applications: WB, IHC
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA

Publications for PYDC2 Antibody (NBP2-31035) (0)

There are no publications for PYDC2 Antibody (NBP2-31035).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PYDC2 Antibody (NBP2-31035) (0)

There are no reviews for PYDC2 Antibody (NBP2-31035). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PYDC2 Antibody (NBP2-31035) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Bioinformatics Tool for PYDC2 Antibody (NBP2-31035)

Discover related pathways, diseases and genes to PYDC2 Antibody (NBP2-31035). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PYDC2

There are no specific blogs for PYDC2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PYDC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PYDC2
Uniprot