Recombinant Human Puromycin-sensitive aminopeptidase/NPEPPS Protein

Order Details


    • Catalog Number
      H00009520-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Puromycin-sensitive aminopeptidase/NPEPPS Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 776-875 of Human NPEPPS partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
NPEPPS

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Puromycin-sensitive aminopeptidase/NPEPPS Protein

  • AAP-S
  • aminopeptidase puromycin sensitive
  • Cytosol alanyl aminopeptidase
  • EC 3.4.11.2
  • EC 3.4.11.3
  • metalloproteinase MP100
  • MP100
  • MP100EC 3.4.11
  • NPEPPS
  • PSAEC 3.4.11.14
  • puromycin-sensitive aminopeptidase

Background

This gene encodes the puromycin-sensitive aminopeptidase, a zinc metallopeptidase which hydrolyzes amino acids from the N-terminus of its substrate. The protein has been localized to both the cytoplasm and to cellular membranes. This enzyme degrades enkaphalins in the brain, and studies in mouse suggest that it is involved in proteolytic events regulating the cell cycle. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
H00009520-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01) (0)

There are no publications for Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01) (0)

There are no reviews for Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Puromycin-sensitive aminopeptidase/NPEPPS Products

Bioinformatics Tool for Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01)

Discover related pathways, diseases and genes to Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01)

Discover more about diseases related to Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01).
 

Pathways for Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01)

View related products by pathway.

PTMs for Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01)

Learn more about PTMs related to Puromycin-sensitive aminopeptidase/NPEPPS Partial Recombinant Protein (H00009520-Q01).

Blogs on Puromycin-sensitive aminopeptidase/NPEPPS

There are no specific blogs for Puromycin-sensitive aminopeptidase/NPEPPS, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Puromycin-sensitive aminopeptidase/NPEPPS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPEPPS
Entrez