PURB Antibody


Western Blot: PURB Antibody [NBP1-70691] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Bv, Rb, ZeSpecies Glossary
Applications WB

Order Details

PURB Antibody Summary

Synthetic peptides corresponding to PURB(purine-rich element binding protein B) The peptide sequence was selected from the N terminal of PURB. Peptide sequence MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PURB and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PURB Antibody

  • MGC126784
  • purine-rich element binding protein B


This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of euka


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Ca(-), Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Am
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb, Ze
Applications: WB

Publications for PURB Antibody (NBP1-70691) (0)

There are no publications for PURB Antibody (NBP1-70691).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PURB Antibody (NBP1-70691) (0)

There are no reviews for PURB Antibody (NBP1-70691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PURB Antibody (NBP1-70691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PURB Products

Array NBP1-70691

Bioinformatics Tool for PURB Antibody (NBP1-70691)

Discover related pathways, diseases and genes to PURB Antibody (NBP1-70691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PURB Antibody (NBP1-70691)

Discover more about diseases related to PURB Antibody (NBP1-70691).

Pathways for PURB Antibody (NBP1-70691)

View related products by pathway.

PTMs for PURB Antibody (NBP1-70691)

Learn more about PTMs related to PURB Antibody (NBP1-70691).

Blogs on PURB

There are no specific blogs for PURB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PURB Antibody and receive a gift card or discount.


Gene Symbol PURB