Recombinant Human PU.1/Spi-1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related PU.1/Spi-1 Peptides and Proteins

Order Details


    • Catalog Number
      H00006688-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human PU.1/Spi-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-120 of Human SPI1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSP

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
SPI1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PU.1/Spi-1 Protein

  • hematopoietic transcription factor PU.1
  • OF
  • PU.1
  • SFPI1
  • SFPI131 kDa transforming protein
  • SPI-1 proto-oncogene
  • SPI1
  • Spi-1
  • SPI-A
  • spleen focus forming virus (SFFV) proviral integration oncogene spi1,31 kDa-transforming protein
  • transcription factor PU.1

Background

SPI1 - spleen focus forming virus (SFFV) proviral integration oncogene spi1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17791
Species: Hu, Mu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-37458
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF5117
Species: Hu
Applications: WB, IHC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF3487
Species: Hu
Applications: WB, IHC, ICC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00006688-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01) (0)

There are no publications for PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01) (0)

There are no reviews for PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PU.1/Spi-1 Products

Bioinformatics Tool for PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01)

Discover related pathways, diseases and genes to PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01)

Discover more about diseases related to PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01).
 

Pathways for PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01)

View related products by pathway.

PTMs for PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01)

Learn more about PTMs related to PU.1/Spi-1 Partial Recombinant Protein (H00006688-Q01).

Blogs on PU.1/Spi-1

There are no specific blogs for PU.1/Spi-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PU.1/Spi-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPI1
Entrez