PU.1/Spi-1 Antibody (2G1) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related PU.1/Spi-1 Primary Antibodies

Order Details


    • Catalog Number
      H00006688-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PU.1/Spi-1 Antibody (2G1) [DyLight 488] Summary

Immunogen
SPI1 (NP_003111, 1 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSP
Specificity
SPI1 - spleen focus forming virus (SFFV) proviral integration oncogene spi1 (2G1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPI1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PU.1/Spi-1 Antibody (2G1) [DyLight 488]

  • hematopoietic transcription factor PU.1
  • OF
  • PU.1
  • SFPI1
  • SFPI131 kDa transforming protein
  • SPI-1 proto-oncogene
  • SPI1
  • Spi-1
  • SPI-A
  • spleen focus forming virus (SFFV) proviral integration oncogene spi1,31 kDa-transforming protein
  • transcription factor PU.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17791
Species: Hu, Mu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-37458
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-83123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF3487
Species: Hu
Applications: WB, IHC, ICC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00006688-M02G
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for PU.1/Spi-1 Antibody (H00006688-M02G) (0)

There are no publications for PU.1/Spi-1 Antibody (H00006688-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PU.1/Spi-1 Antibody (H00006688-M02G) (0)

There are no reviews for PU.1/Spi-1 Antibody (H00006688-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PU.1/Spi-1 Antibody (H00006688-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PU.1/Spi-1 Products

Bioinformatics Tool for PU.1/Spi-1 Antibody (H00006688-M02G)

Discover related pathways, diseases and genes to PU.1/Spi-1 Antibody (H00006688-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PU.1/Spi-1 Antibody (H00006688-M02G)

Discover more about diseases related to PU.1/Spi-1 Antibody (H00006688-M02G).
 

Pathways for PU.1/Spi-1 Antibody (H00006688-M02G)

View related products by pathway.

PTMs for PU.1/Spi-1 Antibody (H00006688-M02G)

Learn more about PTMs related to PU.1/Spi-1 Antibody (H00006688-M02G).

Blogs on PU.1/Spi-1

There are no specific blogs for PU.1/Spi-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PU.1/Spi-1 Antibody (2G1) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol SPI1
Entrez