PTRHD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PTRHD1 Antibody [NBP1-93543] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PTRHD1 Antibody [NBP1-93543] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTRHD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTRHD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTRHD1 Protein (NBP1-93543PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTRHD1 Antibody

  • C2orf79
  • peptidyl-tRNA hydrolase domain containing 1
  • peptidyl-tRNA hydrolase domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP1-76240
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-92683
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-81956
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-83915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86566
Species: Hu
Applications: WB, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
NBP1-80857
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59027
Species: Hu
Applications: WB
NBP2-19795
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89714
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP3-10769
Species: Hu
Applications: WB
NBP1-81075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88979
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PTRHD1 Antibody (NBP1-93543) (0)

There are no publications for PTRHD1 Antibody (NBP1-93543).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTRHD1 Antibody (NBP1-93543) (0)

There are no reviews for PTRHD1 Antibody (NBP1-93543). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PTRHD1 Antibody (NBP1-93543) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PTRHD1 Products

Array NBP1-93543

Bioinformatics Tool for PTRHD1 Antibody (NBP1-93543)

Discover related pathways, diseases and genes to PTRHD1 Antibody (NBP1-93543). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PTRHD1

There are no specific blogs for PTRHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTRHD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTRHD1