PTRH2 Antibody

Images

 
Western Blot: PTRH2 Antibody [NBP1-59816] - Jurkat cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Product Discontinued
View other related PTRH2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59816
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PTRH2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PTRH2(peptidyl-tRNA hydrolase 2) The peptide sequence was selected from the C terminal of PTRH2. Peptide sequence RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT.
Clonality
Polyclonal
Host
Rabbit
Gene
PTRH2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PTRH2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PTRH2 Antibody

  • Bcl-2 inhibitor of transcription 1
  • BIT1CGI-147
  • EC 3.1.1.29
  • mitochondrial
  • peptidyl-tRNA hydrolase 2
  • PTH2FLJ32471

Background

The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-76645
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-40067
Species: Hu, Mu, Po, Bv, Ca, Eq, Mk, Pm
Applications: WB, ICC/IF, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-40364
Species: Hu
Applications: WB, IHC, IP
NBP2-46134
Species: Hu
Applications: WB, Flow, IHC, IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59816
Species: Hu
Applications: WB

Publications for PTRH2 Antibody (NBP1-59816) (0)

There are no publications for PTRH2 Antibody (NBP1-59816).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTRH2 Antibody (NBP1-59816) (0)

There are no reviews for PTRH2 Antibody (NBP1-59816). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTRH2 Antibody (NBP1-59816) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTRH2 Products

Bioinformatics Tool for PTRH2 Antibody (NBP1-59816)

Discover related pathways, diseases and genes to PTRH2 Antibody (NBP1-59816). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PTRH2

There are no specific blogs for PTRH2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTRH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTRH2