PTPNS1L2 Antibody

Images

 
Immunohistochemistry: PTPNS1L2 Antibody [NBP2-31924] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry: PTPNS1L2 Antibody [NBP2-31924] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTPNS1L2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FHVQQTEMSQTVSTGESIILSCSVPDTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIRPD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PTPNS1L2 Protein (NBP2-31924PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTPNS1L2 Antibody

  • dJ576H24.4
  • Protein tyrosine phosphatase non-receptor type substrate 1-like 2
  • protein tyrosine phosphatase, non-receptor type substrate 1-like 2
  • PTPNS1L2
  • signal-regulatory protein delta
  • SIRP-delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTPNS1L2 Antibody (NBP2-31924) (0)

There are no publications for PTPNS1L2 Antibody (NBP2-31924).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPNS1L2 Antibody (NBP2-31924) (0)

There are no reviews for PTPNS1L2 Antibody (NBP2-31924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PTPNS1L2 Antibody (NBP2-31924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTPNS1L2 Products

Bioinformatics Tool for PTPNS1L2 Antibody (NBP2-31924)

Discover related pathways, diseases and genes to PTPNS1L2 Antibody (NBP2-31924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for PTPNS1L2 Antibody (NBP2-31924)

Find related products by research area.

Blogs on PTPNS1L2

There are no specific blogs for PTPNS1L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPNS1L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRPD
Uniprot