PTPN6 Antibody

Images

 
Western Blot: PTPN6 Antibody [NBP1-83276] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: PTPN6 Antibody [NBP1-83276] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: PTPN6 Antibody [NBP1-83276] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Western Blot: PTPN6 Antibody [NBP1-83276] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTPN6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPN6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTPN6 Protein (NBP1-83276PEP)
Publications
Read Publication using NBP1-83276.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTPN6 Antibody

  • HCPH
  • HCPSH-PTP1
  • hematopoietic cell phosphatase
  • Hematopoietic cell protein-tyrosine phosphatase
  • HPTP1C
  • protein tyrosine phosphatase, non-receptor type 6
  • Protein-tyrosine phosphatase 1C
  • Protein-tyrosine phosphatase SHP-1
  • PTP1C
  • PTP-1CEC 3.1.3.48
  • SHP1
  • SHP-1
  • SHP-1L
  • tyrosine-protein phosphatase non-receptor type 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2988
Species: Mu, Rt
Applications: WB
MAB7475
Species: Hu, Rt
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-46522
Species: Hu
Applications: WB, IHC
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC

Publications for PTPN6 Antibody (NBP1-83276)(1)


Reviews for PTPN6 Antibody (NBP1-83276) (0)

There are no reviews for PTPN6 Antibody (NBP1-83276). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTPN6 Antibody (NBP1-83276) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTPN6 Products

Bioinformatics Tool for PTPN6 Antibody (NBP1-83276)

Discover related pathways, diseases and genes to PTPN6 Antibody (NBP1-83276). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPN6 Antibody (NBP1-83276)

Discover more about diseases related to PTPN6 Antibody (NBP1-83276).
 

Pathways for PTPN6 Antibody (NBP1-83276)

View related products by pathway.

PTMs for PTPN6 Antibody (NBP1-83276)

Learn more about PTMs related to PTPN6 Antibody (NBP1-83276).
 

Research Areas for PTPN6 Antibody (NBP1-83276)

Find related products by research area.

Blogs on PTPN6

There are no specific blogs for PTPN6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPN6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPN6