PTP1B/PTPN1 Antibody

Images

 
Western Blot: PTP1B/PTPN1 Antibody [H00005770-B01P] - Analysis of PTPN1 expression in human spleen.
Western Blot: PTP1B/PTPN1 Antibody [H00005770-B01P] - Analysis of PTPN1 expression in transfected 293T cell line by PTPN1 polyclonal antibody. Lane 1: PTPN1 transfected lysate(47.85 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PTP1B/PTPN1 Antibody Summary

Immunogen
PTPN1 (NP_002818.1, 1 a.a. - 435 a.a.) full-length human protein. MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Specificity
PTPN1 - protein tyrosine phosphatase, non-receptor type 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PTPN1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTP1B/PTPN1 Antibody

  • EC 3.1.3.48
  • protein tyrosine phosphatase 1B
  • protein tyrosine phosphatase, non-receptor type 1
  • Protein-tyrosine phosphatase 1B
  • PTP1B
  • PTP-1B
  • PTP1Bprotein tyrosine phosphatase, placental
  • PTPN1
  • tyrosine-protein phosphatase non-receptor type 1

Background

The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
AF4937
Species: Hu
Applications: WB, IHC
MAB7475
Species: Hu, Rt
Applications: WB
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
MAB1930
Species: Hu, Mu, Rt
Applications: WB
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00005770-B01P
Species: Hu
Applications: WB

Publications for PTP1B/PTPN1 Antibody (H00005770-B01P) (0)

There are no publications for PTP1B/PTPN1 Antibody (H00005770-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTP1B/PTPN1 Antibody (H00005770-B01P) (0)

There are no reviews for PTP1B/PTPN1 Antibody (H00005770-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTP1B/PTPN1 Antibody (H00005770-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTP1B/PTPN1 Products

Bioinformatics Tool for PTP1B/PTPN1 Antibody (H00005770-B01P)

Discover related pathways, diseases and genes to PTP1B/PTPN1 Antibody (H00005770-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTP1B/PTPN1 Antibody (H00005770-B01P)

Discover more about diseases related to PTP1B/PTPN1 Antibody (H00005770-B01P).
 

Pathways for PTP1B/PTPN1 Antibody (H00005770-B01P)

View related products by pathway.

PTMs for PTP1B/PTPN1 Antibody (H00005770-B01P)

Learn more about PTMs related to PTP1B/PTPN1 Antibody (H00005770-B01P).

Blogs on PTP1B/PTPN1

There are no specific blogs for PTP1B/PTPN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTP1B/PTPN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPN1
Entrez
Uniprot