PTP epsilon Antibody (2D10) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related PTP epsilon Primary Antibodies

Order Details


    • Catalog Number
      H00005791-M04PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PTP epsilon Antibody (2D10) [PE] Summary

Immunogen
PTPRE (AAH50062 511 a.a. - 600 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
Specificity
PTPRE (2D10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTPRE
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTP epsilon Antibody (2D10) [PE]

  • DKFZp313F1310
  • EC 3.1.3.48
  • FLJ57799
  • FLJ58245
  • HPTPE
  • protein tyrosine phosphatase epsilon
  • protein tyrosine phosphatase, receptor type, E
  • protein tyrosine phosphatase, receptor type, epsilon polypeptide
  • Protein-tyrosine phosphatase epsilon
  • PTPE
  • receptor-type tyrosine-protein phosphatase epsilon
  • R-PTP-EPSILON

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7475
Species: Hu, Rt
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB6860
Species: Hu
Applications: WB, IP
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS

Publications for PTP epsilon Antibody (H00005791-M04PE) (0)

There are no publications for PTP epsilon Antibody (H00005791-M04PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTP epsilon Antibody (H00005791-M04PE) (0)

There are no reviews for PTP epsilon Antibody (H00005791-M04PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PTP epsilon Antibody (H00005791-M04PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTP epsilon Products

Bioinformatics Tool for PTP epsilon Antibody (H00005791-M04PE)

Discover related pathways, diseases and genes to PTP epsilon Antibody (H00005791-M04PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTP epsilon Antibody (H00005791-M04PE)

Discover more about diseases related to PTP epsilon Antibody (H00005791-M04PE).
 

Pathways for PTP epsilon Antibody (H00005791-M04PE)

View related products by pathway.

PTMs for PTP epsilon Antibody (H00005791-M04PE)

Learn more about PTMs related to PTP epsilon Antibody (H00005791-M04PE).
 

Research Areas for PTP epsilon Antibody (H00005791-M04PE)

Find related products by research area.

Blogs on PTP epsilon

There are no specific blogs for PTP epsilon, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTP epsilon Antibody (2D10) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRE