Recombinant Human PTIP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PTIP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 868-975 of Human PAXIP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PAXIP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PTIP Protein

  • CAGF28
  • PACIP1
  • PAX interacting (with transcription-activation domain) protein 1
  • PAX transactivation activation domain-interacting protein
  • PAX transcription activation domain interacting protein 1 like
  • PAX-interacting protein 1
  • PAXIP1LCAGF29
  • protein encoded by CAG trinucleotide repeats
  • PTIPFLJ41049
  • TNRC2

Background

PAXIP1 - PAX interacting (with transcription-activation domain) protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00058508-R04
Species: Hu
NBP1-89123
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-98280
Species: Hu
Applications: WB
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-395
Species: Hu, Mu
Applications: IP (-), WB, ICC/IF, PLA
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00022976-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PTIP Partial Recombinant Protein (H00022976-Q01) (0)

There are no publications for PTIP Partial Recombinant Protein (H00022976-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTIP Partial Recombinant Protein (H00022976-Q01) (0)

There are no reviews for PTIP Partial Recombinant Protein (H00022976-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTIP Partial Recombinant Protein (H00022976-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTIP Products

Bioinformatics Tool for PTIP Partial Recombinant Protein (H00022976-Q01)

Discover related pathways, diseases and genes to PTIP Partial Recombinant Protein (H00022976-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTIP Partial Recombinant Protein (H00022976-Q01)

Discover more about diseases related to PTIP Partial Recombinant Protein (H00022976-Q01).
 

Pathways for PTIP Partial Recombinant Protein (H00022976-Q01)

View related products by pathway.

PTMs for PTIP Partial Recombinant Protein (H00022976-Q01)

Learn more about PTMs related to PTIP Partial Recombinant Protein (H00022976-Q01).
 

Research Areas for PTIP Partial Recombinant Protein (H00022976-Q01)

Find related products by research area.

Blogs on PTIP

There are no specific blogs for PTIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304
PTIP Antibody
NBP2-33877
ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PTIP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAXIP1