PTH Antibody (2E4.)

Images

 
Immunoprecipitation: PTH Antibody (2E4) [H00005741-M02] - Analysis of PTH transfected lysate using anti-PTH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTH MaxPab rabbit polyclonal antibody.

Product Details

Summary
Product Discontinued
View other related PTH Primary Antibodies

Order Details


    • Catalog Number
      H00005741-M02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PTH Antibody (2E4.) Summary

Immunogen
PTH (NP_000306 32 a.a. - 115 a.a.) full-length recombinant protein. SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Specificity
parathyroid hormone
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTH Antibody (2E4.)

  • Parathormone
  • Parathyrin
  • parathyroid hormone 1
  • parathyroid hormone
  • PTH
  • PTH1

Background

The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-40067
Species: Hu, Mu, Po, Bv, Ca, Eq, Mk, Pm
Applications: WB, ICC/IF, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PTH Antibody (H00005741-M02) (0)

There are no publications for PTH Antibody (H00005741-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTH Antibody (H00005741-M02) (0)

There are no reviews for PTH Antibody (H00005741-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PTH Antibody (H00005741-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTH Products

Bioinformatics Tool for PTH Antibody (H00005741-M02)

Discover related pathways, diseases and genes to PTH Antibody (H00005741-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTH Antibody (H00005741-M02)

Discover more about diseases related to PTH Antibody (H00005741-M02).
 

Pathways for PTH Antibody (H00005741-M02)

View related products by pathway.

PTMs for PTH Antibody (H00005741-M02)

Learn more about PTMs related to PTH Antibody (H00005741-M02).
 

Research Areas for PTH Antibody (H00005741-M02)

Find related products by research area.

Blogs on PTH

There are no specific blogs for PTH, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTH Antibody (2E4.) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTH
Entrez
OMIM
Uniprot