PTGFRN Antibody

Images

 
Immunohistochemistry-Paraffin: PTGFRN Antibody [NBP1-85762] - Staining of human cervix, uterine shows membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTGFRN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGFADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGFRN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PTGFRN Protein (NBP1-85762PEP)
Publications
Read Publication using NBP1-85762.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%). Reactivity reported in scientific literature (PMID: 22813880)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTGFRN Antibody

  • CD9P1
  • EWIF
  • EWI-F
  • FLJ11001
  • FPRP
  • prostaglandin F2 receptor negative regulator
  • prostaglandin F2-alpha receptor regulatory protein
  • SMAP-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF3117
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
H00007103-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB4609
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP2-31687
Species: Hu
Applications: IHC, IHC-P
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
AF4674
Species: Mu
Applications: IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF4788
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for PTGFRN Antibody (NBP1-85762)(1)

Reviews for PTGFRN Antibody (NBP1-85762) (0)

There are no reviews for PTGFRN Antibody (NBP1-85762). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PTGFRN Antibody (NBP1-85762) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTGFRN Products

PTGFRN NBP1-85762

Bioinformatics Tool for PTGFRN Antibody (NBP1-85762)

Discover related pathways, diseases and genes to PTGFRN Antibody (NBP1-85762). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTGFRN Antibody (NBP1-85762)

Discover more about diseases related to PTGFRN Antibody (NBP1-85762).
 

Pathways for PTGFRN Antibody (NBP1-85762)

View related products by pathway.

PTMs for PTGFRN Antibody (NBP1-85762)

Learn more about PTMs related to PTGFRN Antibody (NBP1-85762).

Blogs on PTGFRN

There are no specific blogs for PTGFRN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTGFRN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGFRN