We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PTF1A Recombinant Protein Antigen

Images

 
There are currently no images for PTF1A Recombinant Protein Antigen (NBP3-25079PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PTF1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTF1A

Source: E.coli

Amino Acid Sequence: LLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTF1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25079It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTF1A Recombinant Protein Antigen

  • bHLH transcription factor p48
  • BHLHA29
  • bHLHa29exocrine pancreas-specific transcription factor p48
  • Class A basic helix-loop-helix protein 29
  • p48 DNA-binding subunit of transcription factor PTF1
  • pancreas specific transcription factor, 1a
  • pancreas transcription factor 1 subunit alpha
  • Pancreas-specific transcription factor 1a
  • PTF1A
  • PTF1P48
  • PTF1-p48
  • PTF1-p48class II bHLH protein PTF1A

Background

PTF1A encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2419
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP1-84079
Species: Hu
Applications: IHC,  IHC-P, WB
AF3444
Species: Hu
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NBP1-49672
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
NBP1-89680
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-84382
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-47427
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
AF6277
Species: Hu
Applications: ICC, WB
345-FG
Species: Hu
Applications: BA
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
AF2765
Species: Mu
Applications: IP, Neut, WB
H00011317-P01
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for PTF1A Recombinant Protein Antigen (NBP3-25079PEP) (0)

There are no publications for PTF1A Recombinant Protein Antigen (NBP3-25079PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTF1A Recombinant Protein Antigen (NBP3-25079PEP) (0)

There are no reviews for PTF1A Recombinant Protein Antigen (NBP3-25079PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTF1A Recombinant Protein Antigen (NBP3-25079PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTF1A Products

Research Areas for PTF1A Recombinant Protein Antigen (NBP3-25079PEP)

Find related products by research area.

Blogs on PTF1A

There are no specific blogs for PTF1A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTF1A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTF1A