PTF1A Antibody - BSA Free

Staining of human cell line U2OS shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PTF1A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PTF1A Antibody - BSA Free (NBP3-25079) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein PTF1A using the following amino acid sequence: LLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYR
• Predicted Species: Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTF1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PTF1A Antibody - BSA Free

• bHLH transcription factor p48
• BHLHA29
• bHLHa29exocrine pancreas-specific transcription factor p48
• Class A basic helix-loop-helix protein 29
• p48 DNA-binding subunit of transcription factor PTF1
• pancreas specific transcription factor, 1a
• pancreas transcription factor 1 subunit alpha
• Pancreas-specific transcription factor 1a
• PTF1A
• PTF1P48
• PTF1-p48
• PTF1-p48class II bHLH protein PTF1A

Background

PTF1A encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTF1A