Recombinant Human PTCD2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PTCD2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-236 of Human PTCD2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKDQHLRGFFSDSTSFNILMDMLFIKGKYKSALQVLIEMKNQDVKFTKDTYVLAFAICYKLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLKNAAEGNLSKFVKRHVFSEEVLAKVREKVKDVPALVAKFDEIYGTLHITGQVTTDSLDAVLCHTPRDRKSHTLLLNKRMVSRRTFQPLSQSLLAE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PTCD2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PTCD2 Protein

  • FLJ12598
  • pentatricopeptide repeat domain 2
  • pentatricopeptide repeat-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7257
Species: Hu
Applications: IHC
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-45938
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-37258
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-19436
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79340
Species: Hu
Applications: WB
NBP1-91834
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTCD2 Recombinant Protein (H00079810-P01) (0)

There are no publications for PTCD2 Recombinant Protein (H00079810-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTCD2 Recombinant Protein (H00079810-P01) (0)

There are no reviews for PTCD2 Recombinant Protein (H00079810-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTCD2 Recombinant Protein (H00079810-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTCD2 Products

Bioinformatics Tool for PTCD2 Recombinant Protein (H00079810-P01)

Discover related pathways, diseases and genes to PTCD2 Recombinant Protein (H00079810-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTCD2 Recombinant Protein (H00079810-P01)

Discover more about diseases related to PTCD2 Recombinant Protein (H00079810-P01).
 

Pathways for PTCD2 Recombinant Protein (H00079810-P01)

View related products by pathway.

PTMs for PTCD2 Recombinant Protein (H00079810-P01)

Learn more about PTMs related to PTCD2 Recombinant Protein (H00079810-P01).

Blogs on PTCD2

There are no specific blogs for PTCD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PTCD2 Antibody
NBP1-92303
SLIRP Antibody
NB110-37258

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PTCD2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTCD2