PTBP1 Antibody (3H8) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related PTBP1 Primary Antibodies

Order Details


    • Catalog Number
      H00005725-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PTBP1 Antibody (3H8) [PerCP] Summary

Immunogen
PTBP1 (NP_002810, 45 a.a. - 144 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQ
Specificity
PTBP1 - polypyrimidine tract binding protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTBP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTBP1 Antibody (3H8) [PerCP]

  • Heterogeneous nuclear ribonucleoprotein I
  • heterogeneous nuclear ribonucleoprotein polypeptide I
  • hnRNP I
  • HNRNPI
  • HNRNP-I
  • HNRPI
  • MGC10830
  • MGC8461
  • polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoproteinI)
  • polypyrimidine tract binding protein 1
  • polypyrimidine tract-binding protein 1
  • pPTB
  • PTB-1
  • PTB2
  • PTB3
  • PTB4
  • PTB57 kDa RNA-binding protein PPTB-1
  • PTB-T
  • RNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6106
Species: Hu, Mu, Rt, Am, Bv, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for PTBP1 Antibody (H00005725-M01PCP) (0)

There are no publications for PTBP1 Antibody (H00005725-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTBP1 Antibody (H00005725-M01PCP) (0)

There are no reviews for PTBP1 Antibody (H00005725-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTBP1 Antibody (H00005725-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTBP1 Products

Bioinformatics Tool for PTBP1 Antibody (H00005725-M01PCP)

Discover related pathways, diseases and genes to PTBP1 Antibody (H00005725-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTBP1 Antibody (H00005725-M01PCP)

Discover more about diseases related to PTBP1 Antibody (H00005725-M01PCP).
 

Pathways for PTBP1 Antibody (H00005725-M01PCP)

View related products by pathway.

PTMs for PTBP1 Antibody (H00005725-M01PCP)

Learn more about PTMs related to PTBP1 Antibody (H00005725-M01PCP).

Blogs on PTBP1

There are no specific blogs for PTBP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTBP1 Antibody (3H8) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PTBP1