PSTPIP2 Antibody

Images

 
Western Blot: PSTPIP2 Antibody [NBP1-79924] - Jurkat Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Product Discontinued
View other related PSTPIP2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-79924
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PSTPIP2 Antibody Summary

Immunogen
The immunogen for this antibody is PSTPIP2. Peptide sequence IMDAIHKQKSLQFKKTMDAKKNYEQKCRDKDEAEQAVSRSANLVNPKQQE.
Clonality
Polyclonal
Host
Rabbit
Gene
PSTPIP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against PSTPIP2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PSTPIP2 Antibody

  • MAYP
  • MGC34175
  • PEST phosphatase-interacting protein 2
  • proline-serine-threonine phosphatase interacting protein 2
  • proline-serine-threonine phosphatase-interacting protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85764
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-33931
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6460
Species: Hu
Applications: WB, IHC
NBP2-37289
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB100-2307
Species: Hu
Applications: WB
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
7270-IL/CF
Species: Hu
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-66250
Species: Hu
NBP1-79924
Species: Hu
Applications: WB

Publications for PSTPIP2 Antibody (NBP1-79924) (0)

There are no publications for PSTPIP2 Antibody (NBP1-79924).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSTPIP2 Antibody (NBP1-79924) (0)

There are no reviews for PSTPIP2 Antibody (NBP1-79924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSTPIP2 Antibody (NBP1-79924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PSTPIP2 Antibody (NBP1-79924)

Discover related pathways, diseases and genes to PSTPIP2 Antibody (NBP1-79924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSTPIP2 Antibody (NBP1-79924)

Discover more about diseases related to PSTPIP2 Antibody (NBP1-79924).
 

Pathways for PSTPIP2 Antibody (NBP1-79924)

View related products by pathway.

PTMs for PSTPIP2 Antibody (NBP1-79924)

Learn more about PTMs related to PSTPIP2 Antibody (NBP1-79924).
 

Research Areas for PSTPIP2 Antibody (NBP1-79924)

Find related products by research area.

Blogs on PSTPIP2

There are no specific blogs for PSTPIP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSTPIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSTPIP2
Uniprot