Recombinant Human PSMD6 Protein

Images

 
SDS-Page: Recombinant Human PSMD6 Protein [H00009861-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PSMD6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 292-389 of Human PSMD6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM

Protein/Peptide Type
Partial Recombinant Protein
Gene
PSMD6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PSMD6 Protein

  • 26S proteasome non-ATPase regulatory subunit 6
  • Breast cancer-associated protein SGA-113M
  • KIAA010726S proteasome regulatory subunit S10
  • p42A
  • p44S10
  • PFAAP4
  • Phosphonoformate immuno-associated protein 4
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 6,26S proteasome regulatory subunit RPN7
  • Proteasome regulatory particle subunit p44S10
  • Rpn7
  • S10
  • SGA-113M

Background

PSMD6 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NBP1-57365
Species: Hu
Applications: WB
NB100-345
Species: Hu
Applications: WB, ChIP, IP
AF6574
Species: Mu
Applications: WB
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
H00006192-P01
Species: Hu

Publications for PSMD6 Partial Recombinant Protein (H00009861-Q01) (0)

There are no publications for PSMD6 Partial Recombinant Protein (H00009861-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD6 Partial Recombinant Protein (H00009861-Q01) (0)

There are no reviews for PSMD6 Partial Recombinant Protein (H00009861-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSMD6 Partial Recombinant Protein (H00009861-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSMD6 Products

Bioinformatics Tool for PSMD6 Partial Recombinant Protein (H00009861-Q01)

Discover related pathways, diseases and genes to PSMD6 Partial Recombinant Protein (H00009861-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD6 Partial Recombinant Protein (H00009861-Q01)

Discover more about diseases related to PSMD6 Partial Recombinant Protein (H00009861-Q01).
 

Pathways for PSMD6 Partial Recombinant Protein (H00009861-Q01)

View related products by pathway.

PTMs for PSMD6 Partial Recombinant Protein (H00009861-Q01)

Learn more about PTMs related to PSMD6 Partial Recombinant Protein (H00009861-Q01).

Blogs on PSMD6

There are no specific blogs for PSMD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD20 Antibody (AISB12)
NBP1-43435-0.1mg
PSMD6 Antibody
NBP1-81545

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PSMD6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD6