PSMD14 Antibody (4A10-E8) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related PSMD14 Primary Antibodies

Order Details


    • Catalog Number
      H00010213-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PSMD14 Antibody (4A10-E8) [PerCP] Summary

Immunogen
PSMD14 (AAH09524, 1 a.a. ~ 96 a.a) full length recombinant protein with GST tag.MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNK AVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQC LAAMLDTVVFK
Localization
Cytoplasmic and Nuclear
Specificity
PSMD14 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PSMD14
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSMD14 Antibody (4A10-E8) [PerCP]

  • EC 3.1.2.15
  • EC 3.4.19.-
  • pad1
  • POH126S proteasome non-ATPase regulatory subunit 14,26S proteasome regulatory subunit RPN11
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
  • Rpn11
  • RPN11,26S proteasome-associated PAD1 homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
AF7257
Species: Hu
Applications: IHC
AF5650
Species: Hu
Applications: WB, IHC
NBP1-76831
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1988
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-92240
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57955
Species: Hu
Applications: WB, ICC/IF
NBP1-91834
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31564
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
H00010213-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PSMD14 Antibody (H00010213-M01PCP) (0)

There are no publications for PSMD14 Antibody (H00010213-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMD14 Antibody (H00010213-M01PCP) (0)

There are no reviews for PSMD14 Antibody (H00010213-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSMD14 Antibody (H00010213-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMD14 Products

Bioinformatics Tool for PSMD14 Antibody (H00010213-M01PCP)

Discover related pathways, diseases and genes to PSMD14 Antibody (H00010213-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMD14 Antibody (H00010213-M01PCP)

Discover more about diseases related to PSMD14 Antibody (H00010213-M01PCP).
 

Pathways for PSMD14 Antibody (H00010213-M01PCP)

View related products by pathway.

PTMs for PSMD14 Antibody (H00010213-M01PCP)

Learn more about PTMs related to PSMD14 Antibody (H00010213-M01PCP).
 

Research Areas for PSMD14 Antibody (H00010213-M01PCP)

Find related products by research area.

Blogs on PSMD14

There are no specific blogs for PSMD14, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMD14 Antibody (4A10-E8) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD14